Protein Info for BBR_RS15885 in Bifidobacterium breve UCC2003

Annotation: histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 357 signal peptide" amino acids 1 to 36 (36 residues), see Phobius details transmembrane" amino acids 45 to 68 (24 residues), see Phobius details amino acids 75 to 92 (18 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details PF07730: HisKA_3" amino acids 137 to 202 (66 residues), 26.4 bits, see alignment E=4.1e-10

Best Hits

KEGG orthology group: None (inferred from 99% identity to blf:BLIF_0975)

Predicted SEED Role

"FIG00427152: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (357 amino acids)

>BBR_RS15885 histidine kinase (Bifidobacterium breve UCC2003)
MGVYSSQNLLSWSTIRISLLVAVLCAMLGAAPVWAACLLFAVSGYALLWLFSPLTTIMIA
ALTSIAVLSFVKPRLGAASALAALAALAANNMQNNLTSSNIVGMIIMCLCPLSLGFSLNL
LFAQRQATATLRQRLDREHTARHLHDTISNDLAYMILRIDQASRSDCPADREQYQRQLTD
LRAIAEMALDHTHQVIRQLERTDKPDDRSRIVKTNNDDKTDRKIEQQRERLDDIIQSQRR
RLGGLGFQGDDILGTFDHPLADDILDLLEGLLNELYANIAKHAAPHEWYAVTISFDRRHV
IISASDVLKDEAVRLGLGSGLKRYRTVIESMSGTFDITDDSDNWNANITIPLSVTRR