Protein Info for BBR_RS15840 in Bifidobacterium breve UCC2003

Annotation: VanZ family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 337 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 65 (20 residues), see Phobius details amino acids 97 to 117 (21 residues), see Phobius details amino acids 125 to 151 (27 residues), see Phobius details amino acids 163 to 184 (22 residues), see Phobius details amino acids 204 to 227 (24 residues), see Phobius details amino acids 247 to 267 (21 residues), see Phobius details amino acids 295 to 328 (34 residues), see Phobius details PF04892: VanZ" amino acids 52 to 179 (128 residues), 78.6 bits, see alignment E=7.1e-26 PF06271: RDD" amino acids 196 to 335 (140 residues), 28.8 bits, see alignment E=1.4e-10

Best Hits

KEGG orthology group: None (inferred from 98% identity to bln:Blon_1376)

Predicted SEED Role

"Glycopeptide antibiotics resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (337 amino acids)

>BBR_RS15840 VanZ family protein (Bifidobacterium breve UCC2003)
MGFLKNFSEPFAFAMALWPFVSMLLTVPVLALLYHRDNRIRLSSAIAAYGTVLYLLGLLC
FTLYPMPADAAAYCAAHHLTPQLNPLQFIGDIRTDGLTAVLQIAFNIVFFLPLGFIMGRI
WRWPLLATAVLSFATSLSLETMQLTGLMGVFPCAYRLFDVDDLLWNTTGALIGFALAMLS
LRLIPARVADMTPTTTPGFMRRLITFIIDMTLIGFAVMPTHLFVMIVRSNLPSGSNGSWQ
SMEPFDWTGSILFLAALILFEGVVPWLRGGCTFGGSFTHMTVETRPREGWRRAAFYVARM
ATLIIVLPWHSGGFNLLVFIGLGIFWLVKHQMPYDLI