Protein Info for BBR_RS15835 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 202 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 44 to 65 (22 residues), see Phobius details amino acids 77 to 94 (18 residues), see Phobius details amino acids 100 to 125 (26 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details PF07690: MFS_1" amino acids 18 to 185 (168 residues), 44.1 bits, see alignment E=6.6e-16

Best Hits

KEGG orthology group: None (inferred from 89% identity to bln:Blon_1375)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (202 amino acids)

>BBR_RS15835 MFS transporter (Bifidobacterium breve UCC2003)
MVTVWALTKRVFLSAIILGAMVNIACVASITGAQIMLAARGTRAVMIGLLGTAMGVSTLV
GSLLANKLVDMVPTGRLIAGALALFAVSQMPLLFLHSYAAILICQILAGLPFPALNAGLL
GFLYGKTPDNMQGRASAVFETTVGILGAIVPAAVGWLLQQPGLGFTAVMGMAVVCAMARL
VVALIGPLRRISTPDRWSESEL