Protein Info for BBR_RS15830 in Bifidobacterium breve UCC2003

Annotation: amino acid permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 466 transmembrane" amino acids 21 to 43 (23 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 89 to 111 (23 residues), see Phobius details amino acids 131 to 152 (22 residues), see Phobius details amino acids 164 to 186 (23 residues), see Phobius details amino acids 206 to 228 (23 residues), see Phobius details amino acids 248 to 269 (22 residues), see Phobius details amino acids 293 to 317 (25 residues), see Phobius details amino acids 338 to 359 (22 residues), see Phobius details amino acids 365 to 389 (25 residues), see Phobius details amino acids 411 to 431 (21 residues), see Phobius details amino acids 437 to 456 (20 residues), see Phobius details PF00324: AA_permease" amino acids 21 to 465 (445 residues), 445.3 bits, see alignment E=2.5e-137 PF13520: AA_permease_2" amino acids 22 to 444 (423 residues), 151.5 bits, see alignment E=3.7e-48

Best Hits

Swiss-Prot: 57% identical to YBGF_BACSU: Uncharacterized amino acid permease YbgF (ybgF) from Bacillus subtilis (strain 168)

KEGG orthology group: K03293, amino acid transporter, AAT family (inferred from 98% identity to bll:BLJ_1011)

MetaCyc: 54% identical to CP4-6 prophage; S-methyl-L-methionine transporter (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-486

Predicted SEED Role

"S-methylmethionine permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (466 amino acids)

>BBR_RS15830 amino acid permease (Bifidobacterium breve UCC2003)
MASAGNPKDDTGLERKMESRHLTMISLGGVIGTGLFVSSGYTIHQAGPLGAILAYAVGSL
LVYCVMVSLGELSVAMPYAGSFHMYAKRFIGPGTAFTIAILYWLNWAVALASEFTAAGLL
MQRWFPHSPSWVWSAVFIAVVFALNIMSVRLYGEAEFWFASIKVFAIIAFIVIGLLAIFG
SIPIAGHASAPLLGNFVADGWFPSGIAPIFSTLLTVVFAFSGTEVVGVAAGETKDPSRAI
PKAVHTTVLRLAIFFIGSILVMAALIPWHQAGVDTSPFVLVFQSIGMPFAGDIMNFVVLT
AVLSAANSGLYVCSRMVWSLAKERLIPARFAKTNFRGVPVWAVLFSMAGSLLALLSSVIA
ASTVYLVLVAVSGLATLVVWFSVCVCHIRFRREWTRDGHSADELGYRAPGFPVLPWLAIV
MCIGALVLVVLDETQRSTLYCMIPFVVCCYAAYYALERQRKRENNA