Protein Info for BBR_RS15805 in Bifidobacterium breve UCC2003

Annotation: prolipoprotein diacylglyceryl transferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 20 to 40 (21 residues), see Phobius details amino acids 53 to 71 (19 residues), see Phobius details amino acids 94 to 115 (22 residues), see Phobius details amino acids 122 to 140 (19 residues), see Phobius details amino acids 193 to 212 (20 residues), see Phobius details amino acids 224 to 243 (20 residues), see Phobius details amino acids 255 to 275 (21 residues), see Phobius details TIGR00544: prolipoprotein diacylglyceryl transferase" amino acids 4 to 273 (270 residues), 158.6 bits, see alignment E=1.1e-50 PF01790: LGT" amino acids 14 to 271 (258 residues), 227.5 bits, see alignment E=7.6e-72

Best Hits

Swiss-Prot: 95% identical to LGT_BIFLS: Phosphatidylglycerol--prolipoprotein diacylglyceryl transferase (lgt) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: None (inferred from 96% identity to blf:BLIF_0994)

Predicted SEED Role

"Prolipoprotein diacylglyceryl transferase (EC 2.4.99.-)" (EC 2.4.99.-)

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.99.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>BBR_RS15805 prolipoprotein diacylglyceryl transferase (Bifidobacterium breve UCC2003)
MNLAYIPSPTFSKFQVGPFTIHMYAICILIGICVAVWILTTRWKRYGGTFDQILDTTLVT
VPCALVGARLYHCITTPADYFPPTGNLINILKVWEGGMAIFGGISVGTLVAFLWCRHKHY
PFAIFADAIAPALPVAQAIGRLGNWFNQELYGWPTTLPWGLKLNDADAIGKSEICYSGAE
CPDYKTTLFHPTFLYEMIWNLIGAAIIIYLGHKLADRLRAGQQFAMYLMWYGLGRTWIEN
VRINYSTVILGLRTNVWTAIIVFVIGCILFVVLYQHGPDSKVQARQLAAVTADELERQSI
EEERLRQKKSQRGNMQ