Protein Info for BBR_RS15795 in Bifidobacterium breve UCC2003

Annotation: phosphoribosyl-ATP diphosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR03188: phosphoribosyl-ATP diphosphatase
  • amino acids 5 to 87 (83 residues), 79.5 bits, E=8.7e-27
• PF01503: PRA-PH
  • amino acids 11 to 87 (77 residues), 41 bits, E=9.6e-15

Best Hits

Swiss-Prot: 98% identical to HIS2_BIFLS: Phosphoribosyl-ATP pyrophosphatase (hisE) from Bifidobacterium longum subsp. infantis (strain ATCC 15697 / DSM 20088 / JCM 1222 / NCTC 11817 / S12)

KEGG orthology group: K01523, phosphoribosyl-ATP pyrophosphohydrolase [EC: 3.6.1.31] (inferred from 97% identity to blf:BLIF_0996)

Predicted SEED Role

"Phosphoribosyl-ATP pyrophosphatase (EC 3.6.1.31)" in subsystem Histidine Biosynthesis (EC 3.6.1.31)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• L-histidine biosynthesis (10/10 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of plant hormones
• Histidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.31

Protein Sequence (87 amino acids)

>BBR_RS15795 phosphoribosyl-ATP diphosphatase (Bifidobacterium breve UCC2003)
MKTFESLFAELSEKAKIRPEGSLTVDELDKGTHFIGKKIIEEAGETWMAAEYEGADRTAE
EMSQLLYHVQVMMIKHGLTLEDVYKHL