Protein Info for BBR_RS15700 in Bifidobacterium breve UCC2003

Annotation: rRNA pseudouridine synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 PF01479: S4" amino acids 19 to 61 (43 residues), 46 bits, see alignment 3.4e-16 PF00849: PseudoU_synth_2" amino acids 81 to 211 (131 residues), 64.5 bits, see alignment E=1.3e-21 TIGR00093: pseudouridine synthase" amino acids 84 to 243 (160 residues), 145.4 bits, see alignment E=6.1e-47

Best Hits

Swiss-Prot: 51% identical to Y1370_MYCLE: Uncharacterized RNA pseudouridine synthase ML1370 (ML1370) from Mycobacterium leprae (strain TN)

KEGG orthology group: K06178, ribosomal large subunit pseudouridine synthase B [EC: 5.4.99.12] (inferred from 96% identity to blm:BLLJ_1076)

Predicted SEED Role

"Ribosomal large subunit pseudouridine synthase B (EC 4.2.1.70)" in subsystem Two cell division clusters relating to chromosome partitioning (EC 4.2.1.70)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.70, 5.4.99.12

Use Curated BLAST to search for 4.2.1.70 or 5.4.99.12

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>BBR_RS15700 rRNA pseudouridine synthase (Bifidobacterium breve UCC2003)
MPNAYSRARSAYDDSNAIRLQKLLAQAGFGSRRKCEDMITEGRVEVDGELVTELGTRVDP
HKQQVRVDGSRVRVNPNHVTLALNKPRKVLSAMDDPKGRYTLRDIVGDKYERIFHMGRLD
YDSEGLILMTNDGELSQHVMHPKYEVEKTYIATLEGRISGTVCRRLVTTGVQLDDGWIKL
DHCAIIDSSRDFTMVKVVLHSGKNRIVRRIFGSIGFPVKRLVRTQIGPIKLGELKPGSYR
VLSQAEVRSLSKEVGL