Protein Info for BBR_RS15685 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 461 transmembrane" amino acids 12 to 37 (26 residues), see Phobius details amino acids 71 to 93 (23 residues), see Phobius details amino acids 102 to 123 (22 residues), see Phobius details amino acids 132 to 151 (20 residues), see Phobius details amino acids 179 to 203 (25 residues), see Phobius details amino acids 223 to 246 (24 residues), see Phobius details amino acids 258 to 277 (20 residues), see Phobius details amino acids 289 to 308 (20 residues), see Phobius details amino acids 329 to 356 (28 residues), see Phobius details amino acids 385 to 409 (25 residues), see Phobius details PF19877: DUF6350" amino acids 34 to 403 (370 residues), 179.8 bits, see alignment E=4.3e-57

Best Hits

KEGG orthology group: None (inferred from 68% identity to bln:Blon_1163)

Predicted SEED Role

"Permeases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (461 amino acids)

>BBR_RS15685 hypothetical protein (Bifidobacterium breve UCC2003)
MKDRIRQWVRGAAAALVSMTIYAIALGCYIALMLLVISMEEGGDNLTAGTTNLTQAIVLL
SEGSGFSTDSFTLTITPLLLTVLLIWLIATCIARFKAFAVHSYVVGLVVWLAINAVFASS
VQVSLSLVDEQWMILLKSAATFTVAYLGAALPQSSRVKAAIAWMREQVSEQVVRCLKSGV
ILAFAILAINLLIGLITVITWTVRNHAAVVSVFELSGMENGSRILTTLAMLIWLPNLMLW
AISWLFGAGFSIGELANFTLWMGQSNGLPAVPAFGILPEPIADNLWRTVMLEIPLGIACI
AGLLMIILPQGFACRPLNIRDASKRGSVLASLIYAAGSFCLSAMLTSLIATLLFAISNGS
LGQHRLAHVGVDVMASTRAVGHPMAWGLAVAWLIAIVGTALVFSIGWIIERVKASRTTSH
QTVNPRQTRSDVNVQQSQESKEEQDDKHEPADTSSTGFRLS