Protein Info for BBR_RS15675 in Bifidobacterium breve UCC2003

Annotation: ADP-forming succinate--CoA ligase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08442: ATP-grasp_2
  • amino acids 2 to 194 (193 residues), 185.9 bits, E=1.4e-58
• PF13549: ATP-grasp_5
  • amino acids 3 to 214 (212 residues), 53.6 bits, E=3.9e-18
• PF02786: CPSase_L_D2
  • amino acids 7 to 69 (63 residues), 21.7 bits, E=2.5e-08
• PF00549: Ligase_CoA
  • amino acids 262 to 375 (114 residues), 56.1 bits, E=9e-19

Best Hits

Swiss-Prot: 51% identical to SUCC_MICLC: Succinate--CoA ligase [ADP-forming] subunit beta (sucC) from Micrococcus luteus (strain ATCC 4698 / DSM 20030 / JCM 1464 / NBRC 3333 / NCIMB 9278 / NCTC 2665 / VKM Ac-2230)

KEGG orthology group: K01903, succinyl-CoA synthetase beta subunit [EC: 6.2.1.5] (inferred from 96% identity to bll:BLJ_1040)

Predicted SEED Role

"Succinyl-CoA ligase [ADP-forming] beta chain (EC 6.2.1.5)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 6.2.1.5)

MetaCyc Pathways

• pyruvate fermentation to acetate V (1/3 steps found)
• pyruvate fermentation to acetate VI (1/3 steps found)
• TCA cycle V (2-oxoglutarate synthase) (5/9 steps found)
• TCA cycle I (prokaryotic) (5/10 steps found)
• TCA cycle III (animals) (5/10 steps found)
• TCA cycle VIII (Chlamydia) (2/6 steps found)
• TCA cycle II (plants and fungi) (4/9 steps found)
• adipate biosynthesis (1/5 steps found)
• adipate degradation (1/5 steps found)
• superpathway of glyoxylate bypass and TCA (5/12 steps found)
• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (15/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (12/22 steps found)
• reductive TCA cycle I (4/11 steps found)
• incomplete reductive TCA cycle (1/7 steps found)
• anaerobic energy metabolism (invertebrates, mitochondrial) (2/10 steps found)
• reductive TCA cycle II (3/12 steps found)
• superpathway of anaerobic energy metabolism (invertebrates) (6/17 steps found)
• methylaspartate cycle (6/19 steps found)
• Methanobacterium thermoautotrophicum biosynthetic metabolism (16/56 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• C5-Branched dibasic acid metabolism
• Citrate cycle (TCA cycle)
• Propanoate metabolism
• Reductive carboxylate cycle (CO2 fixation)

Isozymes

Compare fitness of predicted isozymes for: 6.2.1.5

Use Curated BLAST to search for 6.2.1.5

Protein Sequence (400 amino acids)

>BBR_RS15675 ADP-forming succinate--CoA ligase subunit beta (Bifidobacterium breve UCC2003)
MDLYEYQARQLLEEQDIPTPGAIFAQNSHEVAEAADKIGYPCVIKAQVKIGHRGQAGGVK
IAHNRDEAILESESILPMTIHGHKVSGVLVAEAKNILHEYYVSISVDRTSRDFDVLATAN
GGTEVEEIAKEHPEAVKRLHIDALDDFDLEAATKMAASIGFYHADVDQAAQILLKMWQCF
KDNDATLVEINPLAKIGDPDDESTKQLSALDAKISLDDNAAFRHDGWARFVDPIVPDPFE
QRAREHGLHYVHLHGEVGVIGNGAGLVMSSLDAVSGAGEEQGSGIKPANFLDIGGGASAT
VMAESLEIVLSDPQVESVFINVYGGITSCVEVANGILEAVAKLGGSKPIVVRFDGNAAAE
GLHILAEANNPNIHVSETMEGAAQKAAELAAESTQSKEIR