Protein Info for BBR_RS15660 in Bifidobacterium breve UCC2003

Annotation: Holliday junction branch migration DNA helicase RuvB

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 354 PF05496: RuvB_N" amino acids 37 to 195 (159 residues), 240.2 bits, see alignment E=2.6e-75 TIGR00635: Holliday junction DNA helicase RuvB" amino acids 42 to 343 (302 residues), 428.4 bits, see alignment E=6.5e-133 PF07728: AAA_5" amino acids 71 to 189 (119 residues), 26.6 bits, see alignment E=1.6e-09 PF00004: AAA" amino acids 72 to 193 (122 residues), 69.3 bits, see alignment E=1.4e-22 PF17864: AAA_lid_4" amino acids 198 to 271 (74 residues), 92 bits, see alignment E=4.6e-30 PF05491: RuvB_C" amino acids 273 to 342 (70 residues), 84.9 bits, see alignment E=9.1e-28

Best Hits

Swiss-Prot: 96% identical to RUVB_BIFLO: Holliday junction ATP-dependent DNA helicase RuvB (ruvB) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03551, holliday junction DNA helicase RuvB (inferred from 96% identity to blo:BL0729)

Predicted SEED Role

"Holliday junction DNA helicase RuvB" in subsystem DNA-replication or RuvABC plus a hypothetical

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (354 amino acids)

>BBR_RS15660 Holliday junction branch migration DNA helicase RuvB (Bifidobacterium breve UCC2003)
MGKDMNYGTSNTGANEESLRMVSSQPIGNEPVSDEELRPHVLEGFIGQPRLKAQLQLFLD
AARKRDVPPDHILLAGPPGLGKTTLAMIVANELEVPIRVTSGPAVQHAGDLASILSSLDT
GEVLFIDEIHRLPRAAEELLYIAMEDFRVDVMVGKGPGASSIPLTLPRFTVIGATTREGM
LPSPLRARFGFTAHLDFYPHEELEKLIERSASVLGVNLDEGSAHELALRSRGTPRIANRL
LRRVRDWAIVHDLIVVHPADVKEALALYQIDSEGLDRLDIAVLNAIVRNFNGGPVGLNNL
AAMVGEESETVETVCEPYLVREGFMVRTPKGRVATEKAWQHLGITPKDDVSKLF