Protein Info for BBR_RS15595 in Bifidobacterium breve UCC2003

Annotation: fructosamine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 263 transmembrane" amino acids 235 to 251 (17 residues), see Phobius details PF03881: Fructosamin_kin" amino acids 13 to 262 (250 residues), 127 bits, see alignment E=8.8e-41 PF01636: APH" amino acids 26 to 218 (193 residues), 38.4 bits, see alignment E=1.3e-13

Best Hits

KEGG orthology group: None (inferred from 90% identity to blj:BLD_0445)

Predicted SEED Role

"Ribulosamine/erythrulosamine 3-kinase potentially involved in protein deglycation"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (263 amino acids)

>BBR_RS15595 fructosamine kinase (Bifidobacterium breve UCC2003)
MSTYRKSRAFAPQRFFECEGRGLQWLGAAHAQGGPRVVQVYDWGKDYLDIERVNSSSPTA
KAALEFGAALARMHDAGAEYFGSAPEGYDGTCYFGPLQDPVKMDTGEWTDPISYFADGRL
RPMVELGVKRGELDQRDVDLTEKVIEALPDIMGRAAEDKPARIHGDLWSGNVMWTADSGQ
TEAVLIDPAAHGGHREEDLAMLHLFGMSYLTQITEGYQSVHPLKAGWQDRITLWQLYPIA
GHCVFFGGGYVSEYRSMCRSLLK