Protein Info for BBR_RS15585 in Bifidobacterium breve UCC2003

Annotation: heat-inducible transcriptional repressor HrcA

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 365 TIGR00331: heat-inducible transcription repressor HrcA" amino acids 4 to 305 (302 residues), 249.1 bits, see alignment E=4.7e-78 PF08279: HTH_11" amino acids 22 to 57 (36 residues), 21.6 bits, see alignment 1.6e-08 PF01628: HrcA" amino acids 104 to 344 (241 residues), 153 bits, see alignment E=1.2e-48

Best Hits

Swiss-Prot: 81% identical to HRCA_BIFLD: Heat-inducible transcription repressor HrcA (hrcA) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K03705, heat-inducible transcriptional repressor (inferred from 82% identity to blf:BLIF_1085)

Predicted SEED Role

"Heat-inducible transcription repressor HrcA" in subsystem Heat shock dnaK gene cluster extended

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (365 amino acids)

>BBR_RS15585 heat-inducible transcriptional repressor HrcA (Bifidobacterium breve UCC2003)
MTQSRRMLVLRAVVEDYIRSQEPVGSAALSKERDLGVSSATIRNDMAALEDEGYLIQPHT
SAGRVPTEKGYRYFVDRLATVVPLSEAQRRGINSFLSGSVSLKDALQRSARLLSEITGQV
AIVASPSLSKATLRHVELVPVAMSTLLAVVITDTGRVAQHGLTVSAMPTADDINRLSSAV
NEQCNGQSLSSASETVRALGGGTGFETVREAADALADAFASMALDDRANELYMSGTSHLA
HSRSLTDLAPLFDALEEQVVLMKLMSNLSEEPSATGVGVSIGSESHTPELLHASVVSSGY
GRSTSPVANDSERNETSPDQDSTNEPIAFVGSIGPTHMDYAATMAAVRAVARYLTFFVSE
SGSGD