Protein Info for BBR_RS15575 in Bifidobacterium breve UCC2003

Annotation: transaldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 367 TIGR00876: transaldolase" amino acids 12 to 356 (345 residues), 396.7 bits, see alignment E=5.4e-123 PF00923: TAL_FSA" amino acids 15 to 356 (342 residues), 280.6 bits, see alignment E=7.3e-88

Best Hits

Swiss-Prot: 60% identical to TAL_MYCS2: Transaldolase (tal) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to bll:BLJ_1060)

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (367 amino acids)

>BBR_RS15575 transaldolase (Bifidobacterium breve UCC2003)
MTEATQRTSDNGVSIWLDDLSRSRIESGSLQDLIANKNVVGVTTNPSIFQKALSQVGPYD
AQLKELGKVDVETAVRELTTTDVRNATDIFREIAEATDFVDGRVSIEVDPRLAHDTENTA
KQAVELWEKVNRPNAMIKIPATLEGLPAITATLAKGISVNVTLIFSLERYEQVIDAFIEG
IAQADANGHDLKHIGSVASFFVSRVDTAVDKLLEANGSDEAKALEGKAAVANARLAYELF
EKKFAEDPRWADLAAKGAKVQRPLWASTGTKNAAYSDCKYVDELVAKHIVNTMPEKTLNA
LADHGNGAPSIEGTYEESHAVINKLAELGINLKDVTDKLEADGVAAFIKSWDSVLADVQS
GIDRVNA