Protein Info for BBR_RS15575 in Bifidobacterium breve UCC2003

Annotation: transaldolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00876: transaldolase
  • amino acids 12 to 356 (345 residues), 396.7 bits, E=5.4e-123
• PF00923: TAL_FSA
  • amino acids 15 to 356 (342 residues), 280.6 bits, E=7.3e-88

Best Hits

Swiss-Prot: 60% identical to TAL_MYCS2: Transaldolase (tal) from Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155)

KEGG orthology group: K00616, transaldolase [EC: 2.2.1.2] (inferred from 100% identity to bll:BLJ_1060)

Predicted SEED Role

"Transaldolase (EC 2.2.1.2)" in subsystem Folate Biosynthesis or Fructose utilization or Pentose phosphate pathway (EC 2.2.1.2)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• pentose phosphate pathway (8/8 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• pentose phosphate pathway (non-oxidative branch) I (5/5 steps found)
• Rubisco shunt (8/10 steps found)
• formaldehyde assimilation III (dihydroxyacetone cycle) (9/12 steps found)
• formaldehyde assimilation II (assimilatory RuMP Cycle) (6/9 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Pentose phosphate pathway

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.2.1.2

Protein Sequence (367 amino acids)

>BBR_RS15575 transaldolase (Bifidobacterium breve UCC2003)
MTEATQRTSDNGVSIWLDDLSRSRIESGSLQDLIANKNVVGVTTNPSIFQKALSQVGPYD
AQLKELGKVDVETAVRELTTTDVRNATDIFREIAEATDFVDGRVSIEVDPRLAHDTENTA
KQAVELWEKVNRPNAMIKIPATLEGLPAITATLAKGISVNVTLIFSLERYEQVIDAFIEG
IAQADANGHDLKHIGSVASFFVSRVDTAVDKLLEANGSDEAKALEGKAAVANARLAYELF
EKKFAEDPRWADLAAKGAKVQRPLWASTGTKNAAYSDCKYVDELVAKHIVNTMPEKTLNA
LADHGNGAPSIEGTYEESHAVINKLAELGINLKDVTDKLEADGVAAFIKSWDSVLADVQS
GIDRVNA