Protein Info for BBR_RS15570 in Bifidobacterium breve UCC2003

Annotation: branched-chain amino acid transport system II carrier protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 445 transmembrane" amino acids 12 to 32 (21 residues), see Phobius details amino acids 44 to 67 (24 residues), see Phobius details amino acids 79 to 99 (21 residues), see Phobius details amino acids 119 to 138 (20 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 194 to 215 (22 residues), see Phobius details amino acids 230 to 256 (27 residues), see Phobius details amino acids 280 to 309 (30 residues), see Phobius details amino acids 323 to 346 (24 residues), see Phobius details amino acids 351 to 368 (18 residues), see Phobius details amino acids 380 to 405 (26 residues), see Phobius details amino acids 424 to 442 (19 residues), see Phobius details PF05525: Branch_AA_trans" amino acids 8 to 439 (432 residues), 423 bits, see alignment E=7.3e-131 TIGR00796: branched-chain amino acid transport system II carrier protein" amino acids 14 to 430 (417 residues), 374.6 bits, see alignment E=3.2e-116

Best Hits

Swiss-Prot: 40% identical to BRNQ_SALTI: Branched-chain amino acid transport system 2 carrier protein (brnQ) from Salmonella typhi

KEGG orthology group: K03311, branched-chain amino acid:cation transporter, LIVCS family (inferred from 95% identity to bll:BLJ_1061)

Predicted SEED Role

"Branched-chain amino acid transport system carrier protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (445 amino acids)

>BBR_RS15570 branched-chain amino acid transport system II carrier protein (Bifidobacterium breve UCC2003)
MNKLVARQRLVMTFTFFSMFFGAGNLIFPPFVGAQAGSATMPAAIGFIVSAVGLPILGVL
AVTFAGGFDKLAGRVSPKFALFLGVAIMLTIGPCFAIPRTATTSFEMMVAPFVPTSYDWL
AQLIYSLVFFSLAFLFAQHPEKLSKVLGRFMGPLLLVLIAVLFIACLVHGIGTPAKPMGD
YSTNQIARGFLDGYQTMDLLAALYFGIVISANIRAQQVDDESLVQKETAYAGLGTGVLLI
VIYGALSYVGVVSGAIASIDPAKDTGATVLTNLTSSLFGTFGTAFLGVVFVIACLNVCTG
LICTCATYFHTRFQTVAGRTLSYRTWQIIFTVFSFIVSNAGLSAIIKVSVPVLSALYPIA
IVLVLLALTHKKLGARFPRVYFWTVLLVGIASFATCISSLAAVFGGSIGWLDAALAMLPL
QQYQLGWVMPAIIGLAIGIADAPRR