Protein Info for BBR_RS15550 in Bifidobacterium breve UCC2003

Annotation: L-lactate dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00056: Ldh_1_N
  • amino acids 8 to 146 (139 residues), 106.5 bits, E=1.2e-34
• TIGR01771: L-lactate dehydrogenase
  • amino acids 11 to 309 (299 residues), 336.4 bits, E=7.9e-105
• PF02866: Ldh_1_C
  • amino acids 149 to 309 (161 residues), 114.3 bits, E=6.7e-37

Best Hits

Swiss-Prot: 95% identical to LDH1_BIFL2: L-lactate dehydrogenase 1 (ldh1) from Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b)

KEGG orthology group: K00016, L-lactate dehydrogenase [EC: 1.1.1.27] (inferred from 96% identity to bln:Blon_1090)

Predicted SEED Role

"L-lactate dehydrogenase (EC 1.1.1.27)" in subsystem Fermentations: Lactate or Fermentations: Mixed acid (EC 1.1.1.27)

MetaCyc Pathways

• Bifidobacterium shunt (15/15 steps found)
• heterolactic fermentation (16/18 steps found)
• homolactic fermentation (11/12 steps found)
• superpathway of glucose and xylose degradation (14/17 steps found)
• hexitol fermentation to lactate, formate, ethanol and acetate (14/19 steps found)
• superpathway of anaerobic sucrose degradation (14/19 steps found)
• pyruvate fermentation to (S)-lactate (1/1 steps found)
• pyruvate fermentation to acetate and (S)-lactate I (3/4 steps found)
• pyruvate fermentation to acetate and lactate II (3/4 steps found)
• methylglyoxal degradation V (2/3 steps found)
• L-histidine degradation V (1/2 steps found)
• lactate fermentation to acetate, CO₂ and hydrogen (Desulfovibrionales) (3/8 steps found)
• (S)-lactate fermentation to propanoate, acetate and hydrogen (4/13 steps found)

KEGG Metabolic Maps

• Cysteine metabolism
• Glycolysis / Gluconeogenesis
• Propanoate metabolism
• Pyruvate metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.27

Use Curated BLAST to search for 1.1.1.27

Protein Sequence (316 amino acids)

>BBR_RS15550 L-lactate dehydrogenase (Bifidobacterium breve UCC2003)
MVTMNRNKVVIVGTGQVGATTAFSIVTHGLCNELVLIDHFAAKALGEARDLDDGSEFQDR
HVKVRAGDYADCRDADIVVITVGRKPPANSNRMAELGFTVGLVGEVVDNVMASGFDGVIV
MVSNPVDVMAWYAWKRSGLPRTQVLGTGTALDTSRLKTIIGEETGLDPRNVSGFVMGEHG
DSQFTAWSTVSLGGKPFARFLADNQDRFASVSTAEVEEKTRTRGDEIVAAKGGTNFGIAS
TVAGIVQTILWDERRIVPVSTLLDGEYGEHGVFLGVPTELRANGANEIVELELSNEEMAK
MHHSAELVRDHCKGLL