Protein Info for BBR_RS15520 in Bifidobacterium breve UCC2003

Annotation: shikimate 5-dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF08501: Shikimate_dh_N
  • amino acids 8 to 89 (82 residues), 55.8 bits, E=2.2e-19

Best Hits

KEGG orthology group: K00014, shikimate dehydrogenase [EC: 1.1.1.25] (inferred from 83% identity to blo:BL0704)

Predicted SEED Role

"Shikimate 5-dehydrogenase I alpha (EC 1.1.1.25)" in subsystem Chorismate Synthesis or Common Pathway For Synthesis of Aromatic Compounds (DAHP synthase to chorismate) (EC 1.1.1.25)

MetaCyc Pathways

• superpathway of aromatic amino acid biosynthesis (18/18 steps found)
• superpathway of L-tryptophan biosynthesis (13/13 steps found)
• superpathway of L-phenylalanine biosynthesis (10/10 steps found)
• superpathway of L-tyrosine biosynthesis (10/10 steps found)
• chorismate biosynthesis I (7/7 steps found)
• chorismate biosynthesis from 3-dehydroquinate (5/5 steps found)
• chorismate biosynthesis II (archaea) (8/12 steps found)
• superpathway of chorismate metabolism (32/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Phenylalanine, tyrosine and tryptophan biosynthesis

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.1.1.25

Protein Sequence (326 amino acids)

>BBR_RS15520 shikimate 5-dehydrogenase (Bifidobacterium breve UCC2003)
MANHRCAVLGKPIAHSLSPVLHNAAYRSLNLNDWLYDKHEVGEDDLDAFLKGLDSTWAGL
SLTMPLKRTIQPYGTPENLWAKELRVANTAVFDWNDITDDPAWPHGKPAIKLYNTDVIGI
QLAFDHINRELGNHYAGDRAGTALIIGNGNTATSALAACCMMPEIGHITVAARHPGRNAG
LKPVAEKFINTHNPYDEIELSDTSALLNAARTATYVINTIPGLAANGIANVINTDSESHA
EPYSGLLLDVVYNPRPTRLMQAWRAHGGRAIGGEEMLLYQALIQVLLMTGIWDDDPPSDA
DKRLQGTTTEDDHLEIAMRNALEEAL