Protein Info for BBR_RS15475 in Bifidobacterium breve UCC2003

Updated annotation (from data): Histidinol-phosphatase (EC 3.1.3.15)
Rationale: Specifically important in nutrient dropout media with no histidine. This function was confirmed by heterologous complementation, see doi: 10.1101/2023.08.29.555234
Original annotation: HAD family phosphatase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 209 PF13419: HAD_2" amino acids 10 to 188 (179 residues), 51.7 bits, see alignment E=1.8e-17 PF00702: Hydrolase" amino acids 64 to 186 (123 residues), 46.7 bits, see alignment E=7.6e-16 TIGR01509: HAD hydrolase, family IA, variant 3" amino acids 81 to 189 (109 residues), 47.2 bits, see alignment E=1.3e-16 PF13242: Hydrolase_like" amino acids 148 to 203 (56 residues), 28.7 bits, see alignment E=1.5e-10

Best Hits

KEGG orthology group: None (inferred from 90% identity to bll:BLJ_0960)

Predicted SEED Role

"possible alpha beta hydrolase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.1.3.15

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (209 amino acids)

>BBR_RS15475 Histidinol-phosphatase (EC 3.1.3.15) (Bifidobacterium breve UCC2003)
MANSPITDVIFDFCGVLLDWNTRACLEGKFPDDVVNRICANDDPCGFFHYEDRMDAGEDL
ADILPDVRREQGDELAAIFEYYIAHYDDALPRTLPGMVELLEDLKAHGYGVWGLTNWSHE
TFHLAFEKFPRLEELLQGTVVSGVEKMHKPNADIYELALNHFGLTAGNCVFFDDTAKNIV
GANEVGIHGLLFENALQARESLAQLGVRL