Protein Info for BBR_RS15455 in Bifidobacterium breve UCC2003

Annotation: orotate phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00336: orotate phosphoribosyltransferase
  • amino acids 11 to 197 (187 residues), 154 bits, E=1.7e-49
• PF00156: Pribosyltran
  • amino acids 42 to 187 (146 residues), 84.4 bits, E=2.8e-28

Best Hits

Swiss-Prot: 99% identical to PYRE_BIFLD: Orotate phosphoribosyltransferase (pyrE) from Bifidobacterium longum (strain DJO10A)

KEGG orthology group: K00762, orotate phosphoribosyltransferase [EC: 2.4.2.10] (inferred from 98% identity to bll:BLJ_0956)

MetaCyc: 47% identical to orotate phosphoribosyltransferase (Escherichia coli K-12 substr. MG1655)
Orotate phosphoribosyltransferase. [EC: 2.4.2.10]

Predicted SEED Role

"Orotate phosphoribosyltransferase (EC 2.4.2.10)" in subsystem De Novo Pyrimidine Synthesis (EC 2.4.2.10)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (6/6 steps found)
• UMP biosynthesis I (5/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (13/18 steps found)

KEGG Metabolic Maps

• Drug metabolism - other enzymes
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.10

Protein Sequence (231 amino acids)

>BBR_RS15455 orotate phosphoribosyltransferase (Bifidobacterium breve UCC2003)
MAETLAHRFTEFLLESNALKFGDFTLKSGRKSPYFINAGAFDDGKKIATLGAFYAEKISQ
AIVHNTIPRNIDTVFGPAYKGIPLAVSTAIALTAGHNMTVGYTFDRKEKKDHGDGGWMVG
TPLTDGMKVLLVDDVMTAGTAVREVIPKLKAEANVEVVGLVLSVDRMEKTKDSDLSAVKA
VEAEFGFPVLAIANVREIFDAAAKMKNADSTPLLSHDIQQRAAAYLEEYGA