Protein Info for BBR_RS15440 in Bifidobacterium breve UCC2003

Annotation: orotidine-5'-phosphate decarboxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 49% identical to PYRF_RHOBA: Orotidine 5'-phosphate decarboxylase (pyrF) from Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1)

KEGG orthology group: K01591, orotidine-5'-phosphate decarboxylase [EC: 4.1.1.23] (inferred from 96% identity to bln:Blon_1448)

Predicted SEED Role

"Orotidine 5'-phosphate decarboxylase (EC 4.1.1.23)" in subsystem De Novo Pyrimidine Synthesis (EC 4.1.1.23)

MetaCyc Pathways

superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
UMP biosynthesis II (6/6 steps found)
UMP biosynthesis III (6/6 steps found)
UMP biosynthesis I (5/6 steps found)
superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (13/18 steps found)

KEGG Metabolic Maps

Pyrimidine metabolism

Isozymes

Compare fitness of predicted isozymes for: 4.1.1.23

Use Curated BLAST to search for 4.1.1.23

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (317 amino acids)

>BBR_RS15440 orotidine-5'-phosphate decarboxylase (Bifidobacterium breve UCC2003)
MDRLIEAIDNTQNPSVVGLDPTEALVPPQVVASFADEVRDSVESPEELESAQLAVAYFEY
NRTIIDAIADIVPAVKPQIAMYEALGPAGVDIYTMTCEYANQQGLYVLGDIKRGDIGSTA
AAYAHHLHGVGDFDPWHEDAVTVNPYLGTDGITPFVEAATEADKDIFVLVRTSNPSSSEL
QMLDLADGTKVYEHVADLVESWGAETIGDHGYSRVGAVVGATHPEEGKALRARMPHTFFL
VPGYGAQGGTAADVAGMFDEQGSGAVVNSSRGIIGAWKKSGKYSESMTADEALGLVADST
RQAALDMRDNLRVAVYR