Protein Info for BBR_RS15430 in Bifidobacterium breve UCC2003

Annotation: aspartate carbamoyltransferase regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 139 PF01948: PyrI" amino acids 1 to 88 (88 residues), 96.3 bits, see alignment E=1e-31 PF02748: PyrI_C" amino acids 95 to 137 (43 residues), 52.2 bits, see alignment E=4.4e-18

Best Hits

Swiss-Prot: 98% identical to PYRI_BIFLO: Aspartate carbamoyltransferase regulatory chain (pyrI) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00610, aspartate carbamoyltransferase regulatory subunit (inferred from 97% identity to bln:Blon_1450)

Predicted SEED Role

"Aspartate carbamoyltransferase regulatory chain (PyrI)" in subsystem De Novo Pyrimidine Synthesis

MetaCyc Pathways

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (139 amino acids)

>BBR_RS15430 aspartate carbamoyltransferase regulatory subunit (Bifidobacterium breve UCC2003)
MEVTSIQNGIIIDHVPAGTSLKVLDYLKIDPSKTKLALIMNADSKRYGSKDIIKIEDDKD
IDLDVLGFVARQATVDVVRGGKIVEKKQPNLPEHIVGVISCVNPRCVTTTEPGIKQMFHL
VHSERLEYRCDYCDEEAKL