Protein Info for BBR_RS15430 in Bifidobacterium breve UCC2003

Annotation: aspartate carbamoyltransferase regulatory subunit

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF01948: PyrI
  • amino acids 1 to 88 (88 residues), 96.3 bits, E=1e-31
• PF02748: PyrI_C
  • amino acids 95 to 137 (43 residues), 52.2 bits, E=4.4e-18

Best Hits

Swiss-Prot: 98% identical to PYRI_BIFLO: Aspartate carbamoyltransferase regulatory chain (pyrI) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00610, aspartate carbamoyltransferase regulatory subunit (inferred from 97% identity to bln:Blon_1450)

Predicted SEED Role

"Aspartate carbamoyltransferase regulatory chain (PyrI)" in subsystem De Novo Pyrimidine Synthesis

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (6/6 steps found)
• UMP biosynthesis I (5/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (13/18 steps found)

Protein Sequence (139 amino acids)

>BBR_RS15430 aspartate carbamoyltransferase regulatory subunit (Bifidobacterium breve UCC2003)
MEVTSIQNGIIIDHVPAGTSLKVLDYLKIDPSKTKLALIMNADSKRYGSKDIIKIEDDKD
IDLDVLGFVARQATVDVVRGGKIVEKKQPNLPEHIVGVISCVNPRCVTTTEPGIKQMFHL
VHSERLEYRCDYCDEEAKL