Protein Info for BBR_RS15425 in Bifidobacterium breve UCC2003

Annotation: aspartate carbamoyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF02729: OTCace_N
  • amino acids 4 to 143 (140 residues), 152.7 bits, E=7.8e-49
• TIGR00670: aspartate carbamoyltransferase
  • amino acids 5 to 302 (298 residues), 332.7 bits, E=9.2e-104
• PF00185: OTCace
  • amino acids 151 to 298 (148 residues), 96.4 bits, E=1.9e-31

Best Hits

Swiss-Prot: 98% identical to PYRB_BIFLO: Aspartate carbamoyltransferase (pyrB) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K00609, aspartate carbamoyltransferase catalytic subunit [EC: 2.1.3.2] (inferred from 98% identity to bln:Blon_1451)

Predicted SEED Role

"Aspartate carbamoyltransferase (EC 2.1.3.2)" in subsystem De Novo Pyrimidine Synthesis (EC 2.1.3.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• UMP biosynthesis II (6/6 steps found)
• UMP biosynthesis III (6/6 steps found)
• UMP biosynthesis I (5/6 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (13/18 steps found)

KEGG Metabolic Maps

• Alanine and aspartate metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.3.2

Protein Sequence (320 amino acids)

>BBR_RS15425 aspartate carbamoyltransferase (Bifidobacterium breve UCC2003)
MVGKSVVTLDGLSTNQILDILHKAAYIDGHRKEVAHTCDGRVLATLFYEPSTRTRLSFET
AMLRLGGKVIGFAGAQLASVTKGESIADTLKTVSNYVDVVAIRHPKEGAALVASRAASVP
VINAGDGGHMHPTQTLADLATLQSRFGRITDLTVGLCGDLTFGRTVHSLIETLCRFGNVR
FVLISPDELKTPQYVIDRINATPSCSYVEVRDLASVMGDLDVLYMTRVQKERFFNEDDYL
RLRDTYILDEEKLQLAKPSMAVLHPLPRVNEIAVDVDDDPRAAYFEQVKNGMLVRMALES
TVVGDELPGYEPLNPKEVQA