Protein Info for BBR_RS15395 in Bifidobacterium breve UCC2003

Annotation: tRNA (adenine-N1)-methyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF14801: GCD14_N" amino acids 5 to 55 (51 residues), 71.2 bits, see alignment 1.5e-23 PF01135: PCMT" amino acids 98 to 171 (74 residues), 28 bits, see alignment E=5.7e-10 PF08704: GCD14" amino acids 100 to 268 (169 residues), 71.5 bits, see alignment E=2.8e-23 PF13847: Methyltransf_31" amino acids 125 to 252 (128 residues), 27.5 bits, see alignment E=7.2e-10 PF08241: Methyltransf_11" amino acids 132 to 230 (99 residues), 21.8 bits, see alignment E=7.5e-08 PF13578: Methyltransf_24" amino acids 132 to 230 (99 residues), 27.2 bits, see alignment E=1.8e-09

Best Hits

KEGG orthology group: K07442, tRNA (adenine-N1-)-methyltransferase catalytic subunit [EC: 2.1.1.36] (inferred from 99% identity to blo:BL0800)

Predicted SEED Role

"Protein-L-isoaspartate methyltransferase (EC 2.1.1.77)" (EC 2.1.1.77)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.1.1.36 or 2.1.1.77

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (356 amino acids)

>BBR_RS15395 tRNA (adenine-N1)-methyltransferase (Bifidobacterium breve UCC2003)
MGPRRGALTAGEKVQFTDRKGKKITDQLVAGGSTQTEHGLILHDDVIGRIEGTVILTVHA
KREAQVNQVYPEKDRNKPWKSSRAIGGWEYAVMRPRLADYVLSMPRGAQIMYPKDIAQVI
QLGDIRSGMRVLESGAGSGAMSVNLLDAVGQDGHLTTIELRPEFAKVAQANATLYYGEQP
QWWDLKTGDFDSVAAELPEHWFDRIMLDMLDPWNRLEQAYRVIVPGGVLVSYVTTTTQMS
RLAEALRTAGCWTEPQIQETLERTWKAQGLAVRPDHQMIGHTGFLVVSRAMAPGFEALRK
RDRVTKDTSTDIDSLTEEQREAQIEELELRDISDHKLRKVLRDLDRQVGQLADTDE