Protein Info for BBR_RS15380 in Bifidobacterium breve UCC2003

Annotation: thiaminase II

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF03070: TENA_THI-4
  • amino acids 27 to 234 (208 residues), 147.5 bits, E=2.5e-47
• TIGR04306: thiaminase II
  • amino acids 31 to 234 (204 residues), 160.5 bits, E=2.2e-51

Best Hits

KEGG orthology group: K03707, thiaminase (transcriptional activator TenA) [EC: 3.5.99.2] (inferred from 100% identity to blo:BL0804)

Predicted SEED Role

No annotation

MetaCyc Pathways

• thiamine diphosphate salvage IV (yeast) (6/7 steps found)
• base-degraded thiamine salvage (1/2 steps found)

KEGG Metabolic Maps

• Thiamine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.5.99.2

Protein Sequence (245 amino acids)

>BBR_RS15380 thiaminase II (Bifidobacterium breve UCC2003)
MMTFDAAAFGPITLDHLPPFAQRLREAANLVWEEGYRQPFLRELGNGTLDRERFAFYLLQ
DYRYLNDYAKVHALALTKTQDPEVMRFMADVQNGIFNVESAMHRKYMASYGISEQEMNSV
RQSAFARAYTSNILSIAYGNPLVDVLVAVLPCAWVYADYGQRLAAEFTDTLDSNPYKSWV
DMYKTEEFWSSSAWLIEHIEQLTEHLSAERKDELVDVFVTGVQNEYMFWSSAYDMQYTWK
PEWDV