Protein Info for BBR_RS15365 in Bifidobacterium breve UCC2003

Annotation: alpha/beta hydrolase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 311 PF20434: BD-FAE" amino acids 49 to 273 (225 residues), 141.3 bits, see alignment E=1.1e-44 PF07859: Abhydrolase_3" amino acids 68 to 292 (225 residues), 58.6 bits, see alignment E=2.9e-19 PF00326: Peptidase_S9" amino acids 118 to 293 (176 residues), 58.2 bits, see alignment E=2.9e-19 PF08386: Abhydrolase_4" amino acids 244 to 291 (48 residues), 22.8 bits, see alignment 2.9e-08

Best Hits

KEGG orthology group: None (inferred from 98% identity to blo:BL0807)

Predicted SEED Role

"Esterase/lipase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (311 amino acids)

>BBR_RS15365 alpha/beta hydrolase (Bifidobacterium breve UCC2003)
MQTIDSSKAAENVTGSDGAIHIPSNPTLAGLASLTCNVAYKTGADDLVMDIIAPQSTGDD
DNRRYPTVVFVQGSAWTTPHRDYEIPQLSALAREGFVVATVNHRDASSDPHDVFPAYLED
VKAAIRYLRANARQWHVDPDRLGIWGTSSGGNTSLLVGLTADDPRYADGTNADESDAVKY
VVSCFPPTDMLEAVDAFDDETNPFRLYYFGPFAAVVGATHETGINAEVRQRAADMSPYLQ
VRDDQQYPPMLLLHGTADTVVPYHQSVKMRDRLVEHGVDAQLVLVDGAEHEYDFWSQQVF
DVIFDFIRERS