Protein Info for BBR_RS15345 in Bifidobacterium breve UCC2003

Annotation: transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 147 transmembrane" amino acids 15 to 35 (21 residues), see Phobius details amino acids 47 to 77 (31 residues), see Phobius details amino acids 86 to 108 (23 residues), see Phobius details amino acids 116 to 139 (24 residues), see Phobius details PF00892: EamA" amino acids 59 to 131 (73 residues), 27.5 bits, see alignment E=1.6e-10

Best Hits

KEGG orthology group: K05786, chloramphenicol-sensitive protein RarD (inferred from 99% identity to blj:BLD_0549)

Predicted SEED Role

"COG2962: Predicted permeases"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (147 amino acids)

>BBR_RS15345 transporter (Bifidobacterium breve UCC2003)
MVVRRDFGSYRRADANGIAAPLVSNIGWGVLPLYWRALSSMNAISVLAYRLVATLAAMVA
LLVAFSVLATAIPLAMFSYGVQHSHYLTVSFIQYLNPLIQFCVAVLLLHEPMRAQGYAAF
MVIWVAIAVYSFGAIRAYWERLKPHAR