Protein Info for BBR_RS15220 in Bifidobacterium breve UCC2003

Annotation: trimeric intracellular cation channel family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 59 (23 residues), see Phobius details amino acids 70 to 88 (19 residues), see Phobius details amino acids 97 to 119 (23 residues), see Phobius details amino acids 124 to 144 (21 residues), see Phobius details amino acids 156 to 176 (21 residues), see Phobius details amino acids 188 to 211 (24 residues), see Phobius details PF03458: Gly_transporter" amino acids 13 to 87 (75 residues), 65.7 bits, see alignment E=1.4e-22 amino acids 99 to 173 (75 residues), 72.6 bits, see alignment E=9.7e-25

Best Hits

KEGG orthology group: None (inferred from 91% identity to bln:Blon_1488)

Predicted SEED Role

"FIG00424359: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (256 amino acids)

>BBR_RS15220 trimeric intracellular cation channel family protein (Bifidobacterium breve UCC2003)
MQVALENNIVFVVIDYLAILCWGLSGGLAAIRKGYDIFTIMLCGWLTALGGGLVRDVMLG
ALPPVGITDKGYVLTTLFSGVIAVVAHPEITKLKWTMTVIDALGLGLFAVNGTAKALAYG
SSGMTAVFLGMFTALAGGLIRDLFIGDVPMIIRDKHLYAVPSFIGCILTVLVWRGVRYGW
FDMRSEMLLDVLIVIIVVALRLLSVGFNVTLPGAIERRHVYLPSENRHIQQSGGRGNANT
VDDEDTPQDGSRLSQG