Protein Info for BBR_RS15200 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 427 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 49 to 70 (22 residues), see Phobius details amino acids 79 to 100 (22 residues), see Phobius details amino acids 106 to 125 (20 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 160 to 161 (2 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 213 to 233 (21 residues), see Phobius details amino acids 254 to 275 (22 residues), see Phobius details amino acids 296 to 315 (20 residues), see Phobius details amino acids 322 to 347 (26 residues), see Phobius details amino acids 359 to 382 (24 residues), see Phobius details amino acids 394 to 416 (23 residues), see Phobius details PF07690: MFS_1" amino acids 30 to 374 (345 residues), 93.3 bits, see alignment E=7.3e-31

Best Hits

KEGG orthology group: K08177, MFS transporter, OFA family, oxalate/formate antiporter (inferred from 77% identity to bln:Blon_0037)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (427 amino acids)

>BBR_RS15200 MFS transporter (Bifidobacterium breve UCC2003)
MVNQQHGENRWVRAVIPALLIHISIGTVYCWSVFKQLIADQMHVAPGIVEWGFSLAIFFL
GMSAAFLGPFVEKDIKKSALISTVCFVCGFAGTGVSIAAGWLPGVFIFYGVIMGIGLGVG
YLTPVKNLMLWFADNKGLATGIAVAGFGLAKAIASPVMQWLISTVGLAPMFYILAAVYAM
MMLLGFALIKRPAGYVYSAETRIRRRDIMKKPVFWAIWLAFYLNITCGLALISQEKDILH
DALSILPKYASLNAAQLATAIAGSISVVLAVDAVFNAAGRVGFSTLSDHCKRRETAYLVI
FIMSIAVCALQIFTHSIDNGTLWLIVTMLFLVNAGYGGGFSTLPVLLEQHFGMKSVSTVH
GLALSAWAFAGLSGNQLASFVVSHTADAAHRYSALIPIITVLYAIALASIIAVVLGTKGK
RAAAQSN