Protein Info for BBR_RS15195 in Bifidobacterium breve UCC2003

Annotation: NAD(P) transhydrogenase subunit beta

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 474 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 43 to 61 (19 residues), see Phobius details amino acids 67 to 87 (21 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 128 to 150 (23 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 195 to 216 (22 residues), see Phobius details amino acids 223 to 242 (20 residues), see Phobius details amino acids 248 to 267 (20 residues), see Phobius details PF02233: PNTB" amino acids 15 to 467 (453 residues), 566.9 bits, see alignment E=2e-174

Best Hits

KEGG orthology group: K00325, NAD(P) transhydrogenase subunit beta [EC: 1.6.1.2] (inferred from 97% identity to bln:Blon_1577)

Predicted SEED Role

"NAD(P) transhydrogenase subunit beta (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (474 amino acids)

>BBR_RS15195 NAD(P) transhydrogenase subunit beta (Bifidobacterium breve UCC2003)
MTSATVGAIDIVAWFVYLFSAVLFVVGLHFMNSPKTARKGNQISAFGMVVAVLMAFIVLF
AKGFVNVVAVVVLVVGILIGAVAGVVSAKKVKMTDMPQLVSVFNTVGGGAAALVALNDIL
TKEGTPDIVVLITAGLGILIGSVTFTGSLIAAGKLQGIKWVKKLTMPGKGVWNILFIVLT
IVSLVMLCVQPEQRLLWSILTTVFALCYGLVFVIPIGGADMPVVISVLNACTGTAVAMSG
LAIDNVALIVAGALVGSAGVTLSILMAQAMNRPLLSVLAGGFGGGSDAAAAGDGPEGTMK
ETTADDLAVQLVYAQKVIFVPGFGLAQAQAQRELADLGELLKGHGVEVSYAIHPVAGRMP
GHMNVLLAEANVPYEELVDLDEINPQFPQANVALVVGANDVTNPAARRPGTPVSGMPILD
VDKSQNVVVMKRGRGMGYAGIQNELYFEGNTQMLFGDAKASLQAVIAAVKELIS