Protein Info for BBR_RS15190 in Bifidobacterium breve UCC2003

Annotation: NAD(P) transhydrogenase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12769: PNTB_4TM
  • amino acids 8 to 90 (83 residues), 103.6 bits, E=3.2e-34

Best Hits

KEGG orthology group: K00324, NAD(P) transhydrogenase subunit alpha [EC: 1.6.1.2] (inferred from 99% identity to blm:BLLJ_0765)

Predicted SEED Role

"NAD(P) transhydrogenase alpha subunit (EC 1.6.1.2)" in subsystem Phosphate metabolism (EC 1.6.1.2)

MetaCyc Pathways

• NAD(P)/NADPH interconversion (2/6 steps found)

KEGG Metabolic Maps

• Nicotinate and nicotinamide metabolism

Isozymes

Compare fitness of predicted isozymes for: 1.6.1.2

Use Curated BLAST to search for 1.6.1.2

Protein Sequence (101 amino acids)

>BBR_RS15190 NAD(P) transhydrogenase subunit alpha (Bifidobacterium breve UCC2003)
MPTLVVSITLFVLALLIGIEVIGKVPATLHTPLMSGANSIHGIVIVGVVIVAAEANTPLA
YVFIFLAAVLGTMNVVGGYVVTDRMLEMFKSSKNEKKGESK