Protein Info for BBR_RS15170 in Bifidobacterium breve UCC2003

Annotation: HlyC/CorC family transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 477 transmembrane" amino acids 6 to 30 (25 residues), see Phobius details amino acids 84 to 107 (24 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details PF00571: CBS" amino acids 236 to 287 (52 residues), 31.6 bits, see alignment 1.7e-11 amino acids 300 to 353 (54 residues), 32.8 bits, see alignment 7.3e-12 PF03471: CorC_HlyC" amino acids 370 to 437 (68 residues), 49.1 bits, see alignment E=4.5e-17

Best Hits

KEGG orthology group: None (inferred from 93% identity to bll:BLJ_0891)

Predicted SEED Role

"Magnesium and cobalt efflux protein CorC" in subsystem Copper homeostasis: copper tolerance or Phosphate metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (477 amino acids)

>BBR_RS15170 HlyC/CorC family transporter (Bifidobacterium breve UCC2003)
MEYSSTTLIVITVILVVVAALFVWFSLTMAAAEGAVARVTRASLNNLILEVQTDSESSQF
IKMKKIDKIHRVQRLIADRYATAGSCAFFRIACNVLDGVLVSSIAALWGAELWVGLLAGF
LFAIIVAVVSVLVRPRTAGMTKPVDIMIAHSRIVDLGCKLTPFARIGGDKSSVKGPGRRS
KDSSLSDDEELEKIQLEQGKAAIDRLVESNDFDPEVSEMLRNVLTLSDTLTREIMVPRTD
MICMERDATLASALKLFSRSGFSRVPVIGEDVDDLIGVAYLKDAVRATAFNPAAMERDVE
SIVRQPMLVPESKPVDDLFHEMQRSRQHVAVVVDEYGGIAGMVTIEDAIEQIVGELEDEH
DRTQHTEPEKIGENKWKMPARTPIADLEEIFEIDIDEDDVDTVYGLLTKILGRVPIVGAS
AVTRGLRLTAVDSAGRRKKVSTIVVEPAHVEGSKEDGKTNEEAGGETAESDETADKE