Protein Info for BBR_RS15155 in Bifidobacterium breve UCC2003

Annotation: histidine triad nucleotide-binding protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF11969: DcpS_C
  • amino acids 7 to 106 (100 residues), 90.9 bits, E=8e-30
• PF01230: HIT
  • amino acids 15 to 109 (95 residues), 90.3 bits, E=1.1e-29

Best Hits

Swiss-Prot: 44% identical to YHIT_AQUAE: Uncharacterized HIT-like protein aq_141 (aq_141) from Aquifex aeolicus (strain VF5)

KEGG orthology group: K02503, Hit-like protein involved in cell-cycle regulation (inferred from 95% identity to bll:BLJ_0888)

Predicted SEED Role

"Bis(5'-nucleosyl)-tetraphosphatase (asymmetrical) (EC 3.6.1.17)" (EC 3.6.1.17)

KEGG Metabolic Maps

• Purine metabolism
• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 3.6.1.17

Protein Sequence (112 amino acids)

>BBR_RS15155 histidine triad nucleotide-binding protein (Bifidobacterium breve UCC2003)
MSESDDCLFCKIIAGQIPSSKVYEDETTYAFNDIDPKAKVHVLVVPKKHYANVAELAAAD
PAELAHIVSVAQGIADHEFHGAYRLVFNTGLDAGQTVFHVHAHVMTGEKLDE