Protein Info for BBR_RS15095 in Bifidobacterium breve UCC2003

Annotation: CTP synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR00337: CTP synthase
  • amino acids 13 to 545 (533 residues), 763 bits, E=7.6e-234
• PF06418: CTP_synth_N
  • amino acids 15 to 278 (264 residues), 405.8 bits, E=1.2e-125
• PF00117: GATase
  • amino acids 313 to 544 (232 residues), 117.4 bits, E=1e-37

Best Hits

Swiss-Prot: 98% identical to PYRG_BIFLO: CTP synthase (pyrG) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K01937, CTP synthase [EC: 6.3.4.2] (inferred from 98% identity to blj:BLD_0608)

MetaCyc: 55% identical to CTP synthetase (Bacillus subtilis subtilis 168)
CTP synthase. [EC: 6.3.4.2]

Predicted SEED Role

"CTP synthase (EC 6.3.4.2)" (EC 6.3.4.2)

MetaCyc Pathways

• superpathway of histidine, purine, and pyrimidine biosynthesis (39/46 steps found)
• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of pyrimidine ribonucleotides de novo biosynthesis (7/9 steps found)
• L-glutamine degradation I (1/1 steps found)
• superpathway of pyrimidine nucleobases salvage (3/4 steps found)
• superpathway of pyrimidine deoxyribonucleotides de novo biosynthesis (13/18 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• UTP and CTP dephosphorylation I (5/7 steps found)
• UTP and CTP de novo biosynthesis (2/3 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• UTP and CTP dephosphorylation II (1/3 steps found)
• superpathway of pyrimidine ribonucleosides salvage (6/10 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)

KEGG Metabolic Maps

• Pyrimidine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 6.3.4.2

Protein Sequence (554 amino acids)

>BBR_RS15095 CTP synthase (Bifidobacterium breve UCC2003)
MVRRTHGNSQEHVTKHIFVTGGVVSSLGKGLTASSLGRLLRSRGIKVLQQKLDPYINVDP
GTMNPFQHGEVYVTEDGAETDLDIGHYERFLDVFLSQKANVTTGQIYQEVLRKERAGEYL
GQCVQVIPHITNEIKSRMRAQVSDDVDVIITEIGGTVGDIESQPFLEAAREVRRDLGAEN
CMFVHVSLVPYISAAHELKTKPTQHSVMMLRQLGISPDALVLRSDRPLNQSIKDKISLMC
DVDAEGVVNCVDAPSIYDVPKILFEEGLDAYVVRELGLPFHDVDWDEWADLLERVHHPKH
EVNIAIVGKYIDLPDAYLSVTEAIKAGGFANWAKVNVKWVAADRCETEEGAAAALDNIDG
IVIPGGFGIRGIEGKIGALKFARENKLPALGLCLGLQSMVIEYSRHVLGIEDANSTEFEP
DCANPVIATMEEQKDIVAGKGDMGHTMRLGSYPADLEEGSLVAELYGTTHVTERHRHRYE
VNVAYKNRLREGGLRISGQSPDGELTEFVELPQDVHPFYVATQAHPEFKSRPTKPHPLFA
GLVKASLEHQEARG