Protein Info for BBR_RS15075 in Bifidobacterium breve UCC2003

Annotation: peptidase A24

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Best Hits

KEGG orthology group: K02654, leader peptidase (prepilin peptidase) / N-methyltransferase [EC: 2.1.1.- 3.4.23.43] (inferred from 88% identity to bln:Blon_1599)

Predicted SEED Role

No annotation

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Anthocyanin biosynthesis
• Benzoxazinone biosynthesis
• Biosynthesis of alkaloids derived from shikimate pathway
• Carotenoid biosynthesis - General
• Flavonoid biosynthesis
• Histidine metabolism
• Insect hormone biosynthesis
• Naphthalene and anthracene degradation
• Phenylpropanoid biosynthesis
• Porphyrin and chlorophyll metabolism
• Tryptophan metabolism
• Tyrosine metabolism
• Ubiquinone and menaquinone biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.1.1.-

Use Curated BLAST to search for 2.1.1.- or 3.4.23.43

Protein Sequence (157 amino acids)

>BBR_RS15075 peptidase A24 (Bifidobacterium breve UCC2003)
MPYLFTLPGLLCGLALSIEDVRCRRVPIAWVAVGALLQLAADFAYGVVANDLFVLLQALL
FTVLCCLVQFALALIVPKSLGFGDVTALVPMGLSVGLFGLLPVVVWWLAMGMCGIAWIAW
WTRFDPQRKSPAYAGKVPYAPVILVGAAVAIVVGVVL