Protein Info for BBR_RS15045 in Bifidobacterium breve UCC2003

Annotation: histidine phosphatase family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00300: His_Phos_1
  • amino acids 5 to 213 (209 residues), 90.1 bits, E=7.5e-30

Best Hits

KEGG orthology group: K01834, phosphoglycerate mutase [EC: 5.4.2.1] (inferred from 99% identity to bll:BLJ_0867)

Predicted SEED Role

"Hypothetical, related to broad specificity phosphatases COG0406" in subsystem Experimental tye

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Glycolysis / Gluconeogenesis

Isozymes

Compare fitness of predicted isozymes for: 5.4.2.1

Use Curated BLAST to search for 5.4.2.1

Protein Sequence (224 amino acids)

>BBR_RS15045 histidine phosphatase family protein (Bifidobacterium breve UCC2003)
MILHLHLVRHGQTTFNKYNRLQGWCNAPLTASGLADADRAGHKLEGYDFAAAYCSDTSRA
EITAKRILDINEAAGHARPELTADMHFREQCYGYFEGQDMSLAWTAAGGPHGAKDYNDIV
AKFGLAASRDFLKEADPFHDAESDEEYWTRVEGAFQLIASNPNLKDGDDVLQISHGNTLL
SLGHRFGGPDLDLSERPANGSVTVLDFDTTKPFSQAVTIVSYGK