Protein Info for BBR_RS15010 in Bifidobacterium breve UCC2003

Annotation: glutamine amidotransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF07722: Peptidase_C26
  • amino acids 18 to 240 (223 residues), 195.5 bits, E=1.1e-61
• PF00117: GATase
  • amino acids 92 to 247 (156 residues), 42.7 bits, E=5e-15

Best Hits

KEGG orthology group: K07010, putative glutamine amidotransferase (inferred from 98% identity to bln:Blon_1611)

Predicted SEED Role

"Para-aminobenzoate synthase, amidotransferase component (EC 2.6.1.85)" in subsystem Chorismate: Intermediate for synthesis of PAPA antibiotics, PABA, anthranilate, 3-hydroxyanthranilate and more. or Folate Biosynthesis or Tryptophan synthesis (EC 2.6.1.85)

MetaCyc Pathways

• L-asparagine biosynthesis III (tRNA-dependent) (4/4 steps found)
• glutaminyl-tRNA^gln biosynthesis via transamidation (4/4 steps found)
• ammonia assimilation cycle III (3/3 steps found)
• L-glutamate biosynthesis I (2/2 steps found)
• superpathway of tetrahydrofolate biosynthesis and salvage (9/12 steps found)
• L-glutamine degradation I (1/1 steps found)
• L-glutamate and L-glutamine biosynthesis (5/7 steps found)
• superpathway of tetrahydrofolate biosynthesis (7/10 steps found)
• 4-aminobenzoate biosynthesis I (1/2 steps found)
• L-citrulline biosynthesis (5/8 steps found)
• superpathway of L-citrulline metabolism (7/12 steps found)
• chloramphenicol biosynthesis (1/9 steps found)
• superpathway of candicidin biosynthesis (2/11 steps found)
• superpathway of chorismate metabolism (32/59 steps found)

KEGG Metabolic Maps

• Biosynthesis of phenylpropanoids
• Folate biosynthesis

Isozymes

Compare fitness of predicted isozymes for: 2.6.1.85

Use Curated BLAST to search for 2.6.1.85

Protein Sequence (260 amino acids)

>BBR_RS15010 glutamine amidotransferase (Bifidobacterium breve UCC2003)
MAHRPLIGVVPLWDDTLNSLWMLPGYFDGIIEAGGIPVMLPLTDDEAAIEQLVGQCDGFL
VTGGHDVDPERYGEAAGPKTVKLCKARDRMEERLIPSVIAADKPLLGICRGIQSLNVALG
GTLWQDLPDEHPSPVVHHGDKPPYDPVVHEVSIAPDSPLARALWPLGDNGPSEAEADEVD
SFGRPYHPRAYTLGVNSYHHQAIRTLGQGLEPMATAPDGIVEAVWMPAKRFVWAVQWHPE
FSHRADSNQRRILSAFIDAC