Protein Info for BBR_RS14995 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 405 transmembrane" amino acids 22 to 45 (24 residues), see Phobius details amino acids 271 to 294 (24 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details amino acids 364 to 389 (26 residues), see Phobius details PF02687: FtsX" amino acids 275 to 386 (112 residues), 54.3 bits, see alignment E=6.6e-19

Best Hits

KEGG orthology group: K02004, (no description) (inferred from 91% identity to blo:BL0888)

Predicted SEED Role

"ABC transporter permease protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (405 amino acids)

>BBR_RS14995 ABC transporter permease (Bifidobacterium breve UCC2003)
MPSHIALRGLPLENLKRKPFRTGALLAVVTILALTFFGGTMLTMNLNTGMTSMEKRLGAD
LMVVPQDTAQKAEALLTNGNPSTFYFTRDIATEVKQADGIEQASEQTYISSLAAACCDEK
LQIIGYDPSTDFVIEPWVASQFKGTLEDGKMIAGANVNVSTDGTIELYGRKWPVIAQLAN
TGTSLDNSVFINQATVPDMVAASSKVSKQVMPMEYAGKAVSTVMIKVKQGYEAQTVAENI
KRIDSRFADLGYVYPGGITANTKTSLTALVTYLKVFVAVIWVMGVIVLLAVFASSVNERK
REFASLRIMGATRGMLDVITLKESAIIGLIGGVIGIGVASLVIFPFSSLIGKQLQLPYLQ
AGPAAVIGFIAITIVCSTAIGIVGSLLTMWRLGRPEAYLTLREGE