Protein Info for BBR_RS14980 in Bifidobacterium breve UCC2003

Annotation: xanthine phosphoribosyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

Best Hits

Swiss-Prot: 96% identical to XPT_BIFLO: Xanthine phosphoribosyltransferase (xpt) from Bifidobacterium longum (strain NCC 2705)

KEGG orthology group: K03816, xanthine phosphoribosyltransferase [EC: 2.4.2.22] (inferred from 94% identity to bll:BLJ_0855)

Predicted SEED Role

"Xanthine phosphoribosyltransferase (EC 2.4.2.22)" in subsystem Purine conversions (EC 2.4.2.22)

MetaCyc Pathways

xanthine and xanthosine salvage (1/2 steps found)

KEGG Metabolic Maps

Purine metabolism

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.4.2.22

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (193 amino acids)

>BBR_RS14980 xanthine phosphoribosyltransferase (Bifidobacterium breve UCC2003)
MQELEERIQSEGTVKAGDVLKVDAFLNHQCDVRLFDRMGAAWAKHFAGKHITKILTIEAS
GIGIACVAAQHFGNVPVVFAKKAQSINLDGDQYTTTVYSFTKQKEFPVIVSKKYLNAGDH
VLLIDDFLANGKALRGLIDLCKAAGATVEGIGIAVEKGFQGGGDALRADGYDVDSLAIVE
SMDPGTGEITFRH