Protein Info for BBR_RS14975 in Bifidobacterium breve UCC2003

Annotation: purine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 454 transmembrane" amino acids 31 to 53 (23 residues), see Phobius details amino acids 62 to 83 (22 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 113 to 133 (21 residues), see Phobius details amino acids 139 to 164 (26 residues), see Phobius details amino acids 176 to 196 (21 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 246 to 266 (21 residues), see Phobius details amino acids 288 to 307 (20 residues), see Phobius details amino acids 327 to 348 (22 residues), see Phobius details amino acids 354 to 374 (21 residues), see Phobius details amino acids 385 to 406 (22 residues), see Phobius details amino acids 414 to 435 (22 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 24 to 434 (411 residues), 308.7 bits, see alignment E=6.7e-96 PF00860: Xan_ur_permease" amino acids 28 to 402 (375 residues), 275.7 bits, see alignment E=2.8e-86 TIGR03173: xanthine permease" amino acids 30 to 436 (407 residues), 445.6 bits, see alignment E=1.5e-137

Best Hits

Swiss-Prot: 34% identical to PBUX_BACSU: Xanthine permease (pbuX) from Bacillus subtilis (strain 168)

KEGG orthology group: K03458, nucleobase:cation symporter-2, NCS2 family (inferred from 98% identity to bln:Blon_1618)

Predicted SEED Role

"Xanthine permease" in subsystem Purine Utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (454 amino acids)

>BBR_RS14975 purine permease (Bifidobacterium breve UCC2003)
MSEKKTKNSISFEALSSLDAPVSFWKGIPFGLQHVMAMFVANLAPIFIVASAAKMTPAQS
ATIIQAGLLVAGLGTCLQLYGAWLIGSRLPMVTGISFTYVAAAVAICADKGYGAVVGAVM
VGGLLELVLGLTAKYWRRFVPPIVSAIVVTSIGFSLLNVGATSFGGGSGAKDFGNWQNLT
LGLISLVACLAFQLLMKGTAKQLSVLFGLVVGYVVAICMGKVDFSGFQNLAIVSVPQIMP
FKPEFDWGSIISIGLLYVVSSVEVLGDTAALTKVGLNRTPTERETAGAIAGDGLISTVSG
LFGCLPLTSFAQNIGLVAMTKVVNRKVILSGGVILILASFVPAIAEVFNSLPQAVLGGCT
IMMFGNIILSGFQMIAEAGFTQRNITIAALSLTIGIGFTQVSDIFAQFPALFQQIFASNC
IAVAFVVAVILNAVLPSEEHFLSAPKEAPVADAE