Protein Info for BBR_RS14950 in Bifidobacterium breve UCC2003

Annotation: Pyrazinamidase/Nicotinamidase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00857: Isochorismatase
  • amino acids 4 to 201 (198 residues), 76.5 bits, E=1.5e-25

Best Hits

KEGG orthology group: K08281, nicotinamidase/pyrazinamidase [EC: 3.5.1.- 3.5.1.19] (inferred from 92% identity to bln:Blon_1622)

Predicted SEED Role

"Nicotinamidase (EC 3.5.1.19)" in subsystem NAD and NADP cofactor biosynthesis global or NAD regulation or Redox-dependent regulation of nucleus processes (EC 3.5.1.19)

MetaCyc Pathways

• NAD salvage pathway I (PNC VI cycle) (6/7 steps found)
• NAD salvage pathway V (PNC V cycle) (4/5 steps found)
• aldoxime degradation (1/3 steps found)
• NAD salvage (plants) (6/11 steps found)
• superpathway of NAD biosynthesis in eukaryotes (6/14 steps found)

KEGG Metabolic Maps

• 1,4-Dichlorobenzene degradation
• Caprolactam degradation
• Glutathione metabolism
• Lipopolysaccharide biosynthesis
• Lysine biosynthesis
• Nicotinate and nicotinamide metabolism
• Nucleotide sugars metabolism
• Sphingolipid metabolism

Isozymes

Compare fitness of predicted isozymes for: 3.5.1.-

Use Curated BLAST to search for 3.5.1.- or 3.5.1.19

Protein Sequence (204 amino acids)

>BBR_RS14950 Pyrazinamidase/Nicotinamidase (Bifidobacterium breve UCC2003)
MSKALIVVDVQPTFCEGGELGVEGGNAVAERIADYVNAHRGEYAYIATTQDWHIEPGAHW
SAEPDFVDTWPKHGAAGTPNAELHPAIKVLGIEHHFKKGQYSAAYSGFEGIEDNTDRIQT
REEVDYAQSAGKTLANALKTAGVSRVDVVGIAESHCVKDTALDARKLSFEVTVFEDLTVP
VSEELGVAARKQMAAAGIALVESR