Protein Info for BBR_RS14940 in Bifidobacterium breve UCC2003

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 406 transmembrane" amino acids 13 to 48 (36 residues), see Phobius details amino acids 51 to 56 (6 residues), see Phobius details amino acids 76 to 93 (18 residues), see Phobius details amino acids 99 to 121 (23 residues), see Phobius details amino acids 140 to 159 (20 residues), see Phobius details amino acids 165 to 185 (21 residues), see Phobius details amino acids 233 to 255 (23 residues), see Phobius details amino acids 267 to 285 (19 residues), see Phobius details amino acids 296 to 326 (31 residues), see Phobius details amino acids 328 to 345 (18 residues), see Phobius details amino acids 357 to 373 (17 residues), see Phobius details amino acids 379 to 398 (20 residues), see Phobius details

Best Hits

KEGG orthology group: None (inferred from 99% identity to bll:BLJ_0846)

Predicted SEED Role

"FIG00671967: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (406 amino acids)

>BBR_RS14940 hypothetical protein (Bifidobacterium breve UCC2003)
MRGLSVLSRALRWALVGMTFSMLSNAIFEGSVIPSILIVGLPAWVIAFRKTFNLVIDFAS
PISAWIVQRFGSFRSLATTEGVEGVLCLAVALVPNGWTYWKWLLLALSCLLLMTGQVIDV
ASEVFEVDAAGDDDDMLVKYSGYVAVIASVAGTLLGQVAGSALANASIMAMLLTSSALSF
ACALTRFRTREFMPGFGNDGAGGDDGDGSADESTAADTSHAPQRTPVTRLTRVRLLIASL
LLALIPSLWASYALLGIGSRYGSDMLTVVYAFGGVGSIIGSFVYMRLSAKLGMRAVSAIG
AIATAISLAAVLVPEFAAVCVGWLINNLGYGLLAHGVIVSRQLLLSGGDLAKFSGRARFA
YAIGGAVGTWGGWLGSAHWQILAVVALVLCAGFIPLLKAMPGPVRH