Protein Info for BBR_RS14920 in Bifidobacterium breve UCC2003

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 412 transmembrane" amino acids 19 to 41 (23 residues), see Phobius details amino acids 210 to 234 (25 residues), see Phobius details amino acids 255 to 279 (25 residues), see Phobius details amino acids 291 to 312 (22 residues), see Phobius details amino acids 322 to 343 (22 residues), see Phobius details amino acids 381 to 404 (24 residues), see Phobius details PF12698: ABC2_membrane_3" amino acids 17 to 401 (385 residues), 147.2 bits, see alignment E=3.6e-47

Best Hits

KEGG orthology group: None (inferred from 100% identity to bln:Blon_1630)

Predicted SEED Role

"Streptolysin S export transmembrane permease (SagH)" in subsystem Streptolysin S Biosynthesis and Transport

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (412 amino acids)

>BBR_RS14920 ABC transporter permease (Bifidobacterium breve UCC2003)
MWTTFLVALKANLRNRSALFWMTVFPIVLATMFNGLFGGLAEAYELKPVPMAVIEDTRWQ
QADGARTFVDALAGETESASDDTTYAGIDQKLLTITTVGTVKEAEQRLADGTANGYLTAD
NNGRLAMTVSRETAVTAKDSTQNSGLDISLAALRGVIDLYNRTDAVTRQTIADNPQAALS
RNFWNSVGQNVDMTHETTLTHFQPDAIARYYYALLAMSCMMAMGYSISTVAAAQANLSAL
GIRRTVAPLSRAKQLVAGFLSCWLCSSVALSIALAYIRLACNVSLGGREPAAIFAVIIAS
FMTSSAGTLLGAVPKLSYDTKYGLSSGIACILSLFTGLYGGFAMQISDWIARNAPILGTI
NPAQQVTNLFYDILYYDSYQPFITTCAILLAMSAVFLLAGIAMLRRQRYEHL