Protein Info for BBR_RS14910 in Bifidobacterium breve UCC2003

Annotation: E1-E2 ATPase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 316 transmembrane" amino acids 83 to 103 (21 residues), see Phobius details amino acids 110 to 134 (25 residues), see Phobius details amino acids 260 to 280 (21 residues), see Phobius details amino acids 286 to 302 (17 residues), see Phobius details PF00122: E1-E2_ATPase" amino acids 28 to 143 (116 residues), 78.3 bits, see alignment E=5.4e-26 TIGR01494: HAD ATPase, P-type, family IC" amino acids 46 to 184 (139 residues), 63.5 bits, see alignment E=6.5e-22 PF00689: Cation_ATPase_C" amino acids 250 to 306 (57 residues), 38.3 bits, see alignment E=1.2e-13

Best Hits

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (316 amino acids)

>BBR_RS14910 E1-E2 ATPase (Bifidobacterium breve UCC2003)
MEHNELAGHARLFTYRFRGIGLQAAEIPNLVFAGTSVAQGNGRAVVIHTGMITKFDKIAR
LTQNVEDNVSPLQREFNHLPRQITIFALCIGVVFFILDVLFVHNPLAETFIFSLGMVVAF
ILEGLLPTVTRALAMAVQRMSKRNALVKKISSVESLGSTSVICTDKTGTLTRNEMTVEYL
WTLNHEYQVSGTGYAPKGEITVDGAVHHAADDAVLRELVTGGALCSNAHLHESEPDHDVR
DDHMPSTNGRWQVYGDPTEIVLLVLIAEVPILQTVFHTAPLSWDEYLYLCCIPFVILAIE
ELRKFIWRHRFPTELV