Protein Info for BBR_RS14900 in Bifidobacterium breve UCC2003

Annotation: DNA-binding response regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 217 PF00072: Response_reg" amino acids 3 to 107 (105 residues), 77.4 bits, see alignment E=9.5e-26 PF00196: GerE" amino acids 157 to 210 (54 residues), 54.4 bits, see alignment E=7.8e-19

Best Hits

KEGG orthology group: None (inferred from 82% identity to bln:Blon_1633)

Predicted SEED Role

"regulatory protein, LuxR:Response regulator receiver"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (217 amino acids)

>BBR_RS14900 DNA-binding response regulator (Bifidobacterium breve UCC2003)
MRIAIVDDDPIVCQSLETILTATGTADVLWTANDGGAAVQQYFASPANHPDILLIDIQMP
GKDGLDAAREILPKDPAARILFLTTFADKDYIAQAMALGAKGYLIKQDVAAVGPALQAVM
AGQVVLGAEILGKLTERTTNPADSSNSGNANDSATKLLNDREREIAMLVAKGLDNRDIAA
KLFLSEGTVRNRISVILDKLGLTNRTQLAIIWLNAHQ