Protein Info for BBR_RS14875 in Bifidobacterium breve UCC2003

Annotation: uracil-xanthine permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 transmembrane" amino acids 34 to 54 (21 residues), see Phobius details amino acids 60 to 77 (18 residues), see Phobius details amino acids 83 to 99 (17 residues), see Phobius details amino acids 106 to 129 (24 residues), see Phobius details amino acids 137 to 158 (22 residues), see Phobius details amino acids 165 to 183 (19 residues), see Phobius details amino acids 190 to 209 (20 residues), see Phobius details amino acids 232 to 251 (20 residues), see Phobius details amino acids 309 to 330 (22 residues), see Phobius details amino acids 336 to 359 (24 residues), see Phobius details amino acids 370 to 388 (19 residues), see Phobius details amino acids 393 to 411 (19 residues), see Phobius details TIGR00801: uracil-xanthine permease" amino acids 29 to 405 (377 residues), 298 bits, see alignment E=5.6e-93 PF00860: Xan_ur_permease" amino acids 36 to 386 (351 residues), 243.2 bits, see alignment E=2e-76

Best Hits

KEGG orthology group: None (inferred from 95% identity to bln:Blon_1641)

Predicted SEED Role

"Xanthine/uracil permease family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (429 amino acids)

>BBR_RS14875 uracil-xanthine permease (Bifidobacterium breve UCC2003)
MSNIFQWQLHGDGKTLQPGEVVEPDERLTWTRTAGIGAQHVIAMFGATFLVPILTGFDPS
ATLFFTAMSTALFLLINKNVLPSYLGSSFGFIAPITAVTTANKGIAVASFGIMCTGILLA
LVGVLVHYAGAKWIDIIMPPVVNGAIVAIIGFNLAPSVWTNFKAAPDTAVVTLLAVLLIA
VLFKGLLGRLNILVGVIIGYVYACFRGQVDFSAINDAAWIGFPKFHLPQADFSILPMFLP
VVLVLVAENVGHVKSVAQMTGRNYDNQIGTALMADGLGTMLAGFGGGSGTTTYGENIGVM
AATKVYSTAAYWCAAAFALILSLCPKFGAVINTIPAGVLGGVTTLLYGMIGMIGIRIWVE
NKVNFDKPVNIMVAAITMIIAIGQFAFTIGGTSFNGIAIGTIVILVAYHGLKAIGKAIGT
IAKDDPDVL