Protein Info for BBR_RS14835 in Bifidobacterium breve UCC2003

Annotation: sulfite exporter TauE/SafE family protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 266 signal peptide" amino acids 1 to 20 (20 residues), see Phobius details transmembrane" amino acids 21 to 24 (4 residues), see Phobius details amino acids 43 to 62 (20 residues), see Phobius details amino acids 74 to 93 (20 residues), see Phobius details amino acids 99 to 116 (18 residues), see Phobius details amino acids 148 to 178 (31 residues), see Phobius details amino acids 187 to 206 (20 residues), see Phobius details amino acids 214 to 233 (20 residues), see Phobius details amino acids 244 to 264 (21 residues), see Phobius details PF01925: TauE" amino acids 8 to 256 (249 residues), 166.9 bits, see alignment E=3.2e-53

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 44% identity to nml:Namu_2579)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (266 amino acids)

>BBR_RS14835 sulfite exporter TauE/SafE family protein (Bifidobacterium breve UCC2003)
MVELIVALAVGLGVGVVVGALGAGGGILSVPVLVYLLGQEPHAASAGSLVIVGLTALVSL
IPRSREGHVRWRDGLVFGVLSSVGTVLGSRLSVLVDPRTLMLLFSVLLVAVGVMMLRKAF
RARRADGSGAAGAEGASSGRRGGRGLPLLIACATATGFLTGFFGVGGGFAVVPMLVLALG
FTMREASSTSLLVMIIASVVGLVSRIGTSISVDWMVVVVFALASMCGGLIGAPASRRVRE
STLTLLFGVLLLLVAVGTLVSTLLGN