Protein Info for BBR_RS14780 in Bifidobacterium breve UCC2003

Annotation: XRE family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 184 transmembrane" amino acids 154 to 176 (23 residues), see Phobius details PF01381: HTH_3" amino acids 22 to 52 (31 residues), 26.1 bits, see alignment 3.5e-10

Best Hits

KEGG orthology group: None (inferred from 97% identity to blo:BL0913)

Predicted SEED Role

"Predicted transcriptional regulators"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (184 amino acids)

>BBR_RS14780 XRE family transcriptional regulator (Bifidobacterium breve UCC2003)
MAASEIEQWWIDKFQENLGPIRKVAGWTTQQLADELGVARQTVSNLETGKSPMTKLQYLA
LRTVFSAEIARREDRDLARIIKTLVDDPIEQRIRERRAQEQDGEAVADNAPVNTGCGNAA
DNATAEKRKPSDATLKAAKTAATGKPTLSTAMQALAVITGALASGTAAGIITYLMFPDGG
PNKR