Protein Info for BBR_RS14750 in Bifidobacterium breve UCC2003

Annotation: serine/threonine protein kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 552 transmembrane" amino acids 287 to 312 (26 residues), see Phobius details PF00069: Pkinase" amino acids 59 to 215 (157 residues), 97.2 bits, see alignment E=1.7e-31 PF07714: PK_Tyr_Ser-Thr" amino acids 59 to 205 (147 residues), 63.2 bits, see alignment E=3.7e-21 PF06293: Kdo" amino acids 102 to 163 (62 residues), 21.8 bits, see alignment E=1.7e-08

Best Hits

KEGG orthology group: None (inferred from 76% identity to blf:BLIF_0734)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (552 amino acids)

>BBR_RS14750 serine/threonine protein kinase (Bifidobacterium breve UCC2003)
MDDKQAMHAMSIDDAYHVERTLARGPSGVTELVSIVGTGPFVRKKIPSPLAQRNVWAALS
ACQNNRLPRVEATYELPDRFVIVYDYVPGDTLAHIVEENGRLAPNAAIQFIGQVCEAVQE
LHQHGVIHRDITPANIIVAQDGAHLIDFGIARIQSASNNRSRDTTALGTYGFASPEQYGF
AKTDARSDVFSLGRLLGFMLTGAYPDDNNYDQLLNDNAIVTPHLRAVISQACAFEPSQRP
QSVPEFRQTLFSATDSAAASTQLPSDAQRATRVPRIFDRLNLSKRAIVLWSAAGAVLVIA
AIVGGIIFAGHLGITGPAESPDSSMRSDGSSSNGSGAGNADNADGASGNNGTGTSGADAV
ADNPLELVESGWSVSQQGYVSYAFALRNTSTTLQVQYPEVAITGRAKDGSIVFSQTQTLN
MAFPNQTIYDAGQAGQGTAPATVDFVVLSPNEYNVTEAQGTATFPISGISKVRNNDGGTT
FNGEVRAVTDGFEPSDGQQIKVSLVLRDKQGAIIYGEMAFVDWPDNGQSMPFSIPVYDLP
DYTSYESYAQIW