Protein Info for BBR_RS14745 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 650 683 transmembrane" amino acids 25 to 44 (20 residues), see Phobius details amino acids 64 to 85 (22 residues), see Phobius details amino acids 93 to 116 (24 residues), see Phobius details amino acids 122 to 143 (22 residues), see Phobius details amino acids 153 to 174 (22 residues), see Phobius details amino acids 180 to 201 (22 residues), see Phobius details amino acids 212 to 231 (20 residues), see Phobius details amino acids 238 to 260 (23 residues), see Phobius details amino acids 283 to 305 (23 residues), see Phobius details amino acids 317 to 338 (22 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 370 to 390 (21 residues), see Phobius details amino acids 417 to 434 (18 residues), see Phobius details amino acids 450 to 472 (23 residues), see Phobius details TIGR00711: drug resistance MFS transporter, drug:H+ antiporter-2 (14 Spanner) (DHA2) family" amino acids 27 to 446 (420 residues), 294.8 bits, see alignment E=6e-92 PF07690: MFS_1" amino acids 32 to 195 (164 residues), 130.8 bits, see alignment E=9e-42 amino acids 223 to 422 (200 residues), 60.5 bits, see alignment E=2e-20 PF00571: CBS" amino acids 530 to 584 (55 residues), 44.1 bits, see alignment 3.2e-15 amino acids 619 to 672 (54 residues), 47.8 bits, see alignment 2.2e-16

Best Hits

KEGG orthology group: None (inferred from 98% identity to bad:BAD_1491)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (683 amino acids)

>BBR_RS14745 MFS transporter (Bifidobacterium breve UCC2003)
MTSQKNAEFGSAASSVKPIDPHTRFIVVGVIVVGSFIALLNQTVMSPALPALMRDFNIAT
GTVQWVTSVYMLVSGIMVPISGYLIDKFSTRKLFAGALATFMVGTLLCAVAPNFMLLLVG
RILQSAGSGVLLPLVAVVPMLVYPPDKRGTAMGMAGIVMAAGPAIGPVVGGLVIDSFGWR
PMFIGIAVVALVILVGGTMMLKNVGELKNPKLNILSVILSTIAFGGLLYGFSSASTMGWA
SPVVITSIVVGLVAFVAFVYKQVKLDEPLLRVDTLATRNFRNSAILVTLINAAVAATNVT
LPIFIQNVLGQSATVTGMVMLPAAAVGIIMSPVAGAAFDKFGPRGVGIGGLALMTISLGL
LGTINTRTSVLFVAVFCALQASGQAIANMPINTWGVNALPNDMIAHGNAIANTGRQIAAA
IATSLLVTAETSVTASHMSQGVKSATARGIAFSYLLCAAISLIALIICIFTVTSRAKEKA
ARNAKAYEAQASAEVAAETTEGQPAEHHYAGAYVAPAASLFKQAQEQSIGGIMDDQPYSC
LDSDDITHVVREFIRLNVSSLPVVNGDGRLVGFVSDGDVLKSIATYESRTVSTGTGSTMV
VFDDETVASKVQALSGKKVMDIATRKVVTATPDQHVGEVARILAKKQFKKLPVVNGDGRL
VGVIRRKSVMEHAFDALFPKDDR