Protein Info for BBR_RS14720 in Bifidobacterium breve UCC2003

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 423 transmembrane" amino acids 27 to 50 (24 residues), see Phobius details amino acids 57 to 79 (23 residues), see Phobius details amino acids 90 to 111 (22 residues), see Phobius details amino acids 116 to 137 (22 residues), see Phobius details amino acids 158 to 181 (24 residues), see Phobius details amino acids 187 to 207 (21 residues), see Phobius details amino acids 238 to 256 (19 residues), see Phobius details amino acids 275 to 293 (19 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 333 to 358 (26 residues), see Phobius details amino acids 370 to 389 (20 residues), see Phobius details amino acids 395 to 417 (23 residues), see Phobius details PF05977: MFS_3" amino acids 18 to 403 (386 residues), 61.1 bits, see alignment E=7.6e-21 PF07690: MFS_1" amino acids 30 to 381 (352 residues), 79 bits, see alignment E=3.4e-26

Best Hits

KEGG orthology group: None (inferred from 98% identity to bll:BLJ_0814)

Predicted SEED Role

"Permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (423 amino acids)

>BBR_RS14720 MFS transporter (Bifidobacterium breve UCC2003)
MTNAYECTTQPQRSQAADPLRTRDFRLLVAGLGISLFANLMLRFAMSMWVLDKTGSAAAF
ASILTASILPTILLSPLGGVMADRTNRRTVMVALDALSAVTVLVCVAIFSAAGFNLAAIA
VMQVVLAVLDAMETPTVQAALPQMFRSHGEDVMRRAMAVVNVVNQTSTLVPAVLGGVLYA
AVGAMPMMGLTIVGFGAAAVVECFIRLGAPDRGDAGRVTAVDDLRAAGRFLTRERPHVLH
LVLICAALNFLVTGYAEVGFPYMVRTVLGFGSTAYGLAYGLVGASGLLGALVGGRVARSL
SMRRFPMAIAAFSLTILPQALVMTIPAGGVMRLAVLTASTCGTMIAITLANLIAVPAIQM
GCPENMTGKVMSLALSASMCAQPLGQIAYGWAYSVYPAGAVLAVTFALATAMLPPVAHVT
RRF