Protein Info for BBR_RS14665 in Bifidobacterium breve UCC2003

Annotation: MATE family efflux transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 460 transmembrane" amino acids 21 to 41 (21 residues), see Phobius details amino acids 53 to 79 (27 residues), see Phobius details amino acids 100 to 122 (23 residues), see Phobius details amino acids 142 to 162 (21 residues), see Phobius details amino acids 173 to 197 (25 residues), see Phobius details amino acids 203 to 224 (22 residues), see Phobius details amino acids 242 to 264 (23 residues), see Phobius details amino acids 285 to 309 (25 residues), see Phobius details amino acids 332 to 355 (24 residues), see Phobius details amino acids 375 to 395 (21 residues), see Phobius details amino acids 406 to 425 (20 residues), see Phobius details amino acids 431 to 451 (21 residues), see Phobius details PF01554: MatE" amino acids 28 to 192 (165 residues), 75.3 bits, see alignment E=4.5e-25 amino acids 275 to 417 (143 residues), 57 bits, see alignment E=2e-19 TIGR00797: MATE efflux family protein" amino acids 28 to 428 (401 residues), 153.7 bits, see alignment E=3.5e-49 PF14667: Polysacc_synt_C" amino acids 147 to 284 (138 residues), 34.1 bits, see alignment E=2.8e-12

Best Hits

KEGG orthology group: None (inferred from 98% identity to bln:Blon_1686)

Predicted SEED Role

"Multi antimicrobial extrusion protein (Na(+)/drug antiporter), MATE family of MDR efflux pumps" in subsystem Multidrug Resistance Efflux Pumps

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-positive bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (460 amino acids)

>BBR_RS14665 MATE family efflux transporter (Bifidobacterium breve UCC2003)
MDKTIKTVRGNPLAAEPLGRLLIKFAIPSVLSMLVDALYNIVDQIFIGRGVGYLGIAAAT
VTFPFVTILLSIATLLGIGGSVYTSMNLGAGKEAEAEKTLGTVFTLSVAIGILFTVICLT
FLKPLALAFGATKGAQGSLSYVLDYVPIILLGAPFSMAAIALSSMARACGSPILAMGCFL
VGAVINLVLDPIYIFVFNWGVKGAAIATVTSQIMSAVILLVYFLKKGHIRLRRKNICPTL
PICGQIFAFGLPSCMIQVAVTILQIELNKAVVSCEMAGVGSEAALSSLGIVLRISSVVVA
ICVGIALGMQPIIGFNKGAGFEHRVKETYKKAVGAATVVSVIGWLICELFPAEILQIFGM
NEPASMAFGIKCMRISLFGLAFTGFQVVSAQYYLAAGQAVKAMLLSILRPLLLMVPLIHI
FSGIWGMDGILYAGPTADILTALIAAGLVGYDSRKKRKGV